Tell me more ×
Stack Overflow is a question and answer site for professional and enthusiast programmers. It's 100% free, no registration required.

So, I'm digesting a protein sequence with an enzyme (for your curiosity, Asp-N) which cleaves before the proteins coded by B or D in a single-letter coded sequence. My actual analysis uses String#scan for the captures. I'm trying to figure out why the following regular expression doesn't digest it correctly...

(\w*?)(?=[BD])|(.*\b)

where the antecedent (.*\b) exists to capture the end of the sequence. For:

MTMDKPSQYDKIEAELQDICNDVLELLDSKGDYFRYLSEVASGDN

This should give something like: [MTM, DKPSQY, DKIEAELQ, DICN, DVLELL, DSKG, ... ] but instead misses each D in the sequence.

I've been using http://www.rubular.com for troubleshooting, which runs on 1.8.7 although I've also tested this REGEX on 1.9.2 to no avail. It is my understanding that zero-width lookahead assertions are supported in both versions of ruby. What am I doing wrong with my regex?

share|improve this question
What method are you using? String#scan, String#split or something else? – Andrew Grimm May 18 '11 at 23:38
3  
+1 What a great question. I did not expect the results you got, and further analysis taught me a little something about the way the regex handles repeated zero-width matches. – Phrogz May 19 '11 at 3:01
I am a bit confused by your statement "which cleaves before the proteins coded by B or D". As I understand things, B is the single letter code for either D or N (where it is not known whether the residue is Asp or Asn)? Can Asp-N cleave before Asn? – TomD May 21 '11 at 19:00
1  
@TomD Sorry if my phrasing isn't clear. Asp-N doesn't cleave after Asn, but for analysis purposes, it is assumed that a cleavage occurs, rather than assuming that B represents N. This increases the number of peptide fragments that results, but ensures that you haven't neglected a possible fragment. Makes sense, right? – Ryanmt May 22 '11 at 3:42
@Ryanmt OK, I get the idea now :-) Thanks for that clarification. – TomD May 22 '11 at 19:33
show 1 more comment

2 Answers

up vote 3 down vote accepted

The simplest way to support this is to split on the zero-width lookahead:

s = "MTMDKPSQYDKIEAELQDICNDVLELLDSKG"
p s.split /(?=[BD])/
#=> ["MTM", "DKPSQY", "DKIEAELQ", "DICN", "DVLELL", "DSKG"]

For understanding as to what was going wrong with your solution, let's look first at your regex versus one that works:

p s.scan(/.*?(?=[BD]|$)/)
#=> ["MTM", "", "KPSQY", "", "KIEAELQ", "", "ICN", "", "VLELL", "", "SKG", ""]

p s.scan(/.+?(?=[BD]|$)/)
#=> ["MTM", "DKPSQY", "DKIEAELQ", "DICN", "DVLELL", "DSKG"]

The problem is that if you can capture zero characters and still match your zero-width lookahead, you succeed without advancing the scanning pointer. Let's look at a simpler-but-similar test case:

s = "abcd"
p s.scan //      # Match any position, without advancing
#=> ["", "", "", "", ""]

p s.scan /(?=.)/ # Anywhere that is followed by a character, without advancing
#=> ["", "", "", ""]

A naive implementation of String#scan might get stuck in an infinite loop, repeatedly matching with the pointer before the first character. It appears that once a match occurs without advancing the pointer the algorithm forcibly advances the pointer by one character. This explains the results in your case:

  1. First it matches all the characters up to a B or D,
  2. then it matches the zero-width position right before the B or D, without moving the character pointer,
  3. as a result the algorithm moves the pointer past the B or D, and continues on after that.
share|improve this answer
Perhaps I should simplify, as the other answer does seem to work, but this is really what I was looking for: Understanding! Thank you for explaining why my Regular Expression was broken! – Ryanmt May 19 '11 at 15:06
@Ryanmt I'm glad I could help. I've also modified my regex to show you a simpler way to capture the end of the sequence if you wanted to use this rather than the simpler split-based solution. – Phrogz May 19 '11 at 16:57
Ah. I've read about that but hadn't applied it to my problem. Thanks! – Ryanmt May 19 '11 at 17:48

Basically, you want to cut you string before each B or D?

"...".split(/(?=[BD])/)

Gives you

["MTM", "DKPSQY", "DKIEAELQ", "DICN", "DVLELL", "DSKG", "DYFRYLSEVASG", "DN"]
share|improve this answer
Great answer, and clean. Thanks! – Ryanmt May 19 '11 at 17:49

Your Answer

 
discard

By posting your answer, you agree to the privacy policy and terms of service.

Not the answer you're looking for? Browse other questions tagged or ask your own question.