Tell me more ×
Stack Overflow is a question and answer site for professional and enthusiast programmers. It's 100% free, no registration required.

I have been learning Java for a few months now, and I am faced with a problem that I need some help on. I have a user input file that has many entries in the form:

>Item1 Description
DILDEQCLKGACQGTSVVIHTA
>Item2 Description
DILDEQCLKGACQGTSVVIHTASVIDVRNAV
>Item3 Description
AEKAGTS
>Item4 Description
RNAVPRHESAW

There might be up to 100 items in this file. It's a basic text file and the capitalized sequences will vary depending on the item. I think other readers/parsers rely on the '>' to start the next entry. I suppose I should too.

My goal is to produce a new file from the user input file that contains the same >ItemX Description line but the sequence of letters needs to be reversed. I have experimenting with Scanner, FileInputStream, DataInputStream, and BufferedReader. Not sure what the best way to do this would be and the most efficient.

How should I load these data so that I can reverse the string most easily? It seems there are so many ways to input data, I just seem to be getting more and more lost... I have a string reverser that seems to work, so my goal now is to get these data loaded and then convert to a string for reversal.

Thanks in advance for any assistance.

NOTE - here is what one of these entries might look like:

>41_BOVIN (Q9N179) Protein 4.1 (Band 4.1) (P4.1) (4.1R) MHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAK EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVSGRLPCSFATLALLG SYTIQSELGDYDPELHGADYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKEKLRINRFPWPKVLKISYKRSSFFI KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVEPADRTPRPTSAPAIAPSPA AEGGVPGAPVKKAQKETVQVEVKQEEAPPEDAEPEPSEAWKKKRERLDGENIYIRHSNLM LEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGE GPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQTDDSNGDLDPGVLLTA QTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPD

So I would need to make lines 2 through 12 into one big string and then reverse that.

share|improve this question

1 Answer

up vote 1 down vote accepted

Don't reinvent the wheel! Apache commons libraries have many common programming problems solved for you. Here's two classes that you can use for your problem:

List<String> lines = org.apache.commons.FileUtils.readLines(file);

which does all the I/O work for you and reads the lines of the file in as a List. Then you can use another apache commons class for the reversal:

org.apache.commons.lang.StringUtils.reverse(str);

If you use maven, here are the dependencies:

For the FileUtils class (and many others):

<dependency>
    <groupId>commons-io</groupId>
    <artifactId>commons-io</artifactId>
    <version>2.0.1</version>
</dependency>

For the StringUtils class (and many others):

<dependency>
    <groupId>commons-lang</groupId>
    <artifactId>commons-lang</artifactId>
    <version>2.6</version>
</dependency>
share|improve this answer
This is good. +1 for a great resource for a new programmer! I am reading up on these packages now. One problem I see that I would have to overcome is the fact that these "entries" I discuss aren't necessarily like above. One entry could have the header line and then 10 lines of sequence that needs to be reversed. See original post for an example of one of these entries. – nicorellius Jun 7 '11 at 19:50

Your Answer

 
discard

By posting your answer, you agree to the privacy policy and terms of service.

Not the answer you're looking for? Browse other questions tagged or ask your own question.